Lineage for d6ezha_ (6ezh A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. Protein Acetylcholinesterase [53476] (6 species)
  7. Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (98 PDB entries)
    Uniprot P04058 25-556
  8. Domain d6ezha_: 6ezh A: [360393]
    automated match to d1ea5a_
    complexed with c6h, nag

Details for d6ezha_

PDB Entry: 6ezh (more details), 2.6 Å

PDB Description: torpedo californica ache in complex with indolic multi-target directed ligand
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d6ezha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezha_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d6ezha_ are not available.

Timeline for d6ezha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ezhb_