Lineage for d6ex5b2 (6ex5 B:91-199)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553405Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries)
  8. 2553409Domain d6ex5b2: 6ex5 B:91-199 [360391]
    Other proteins in same PDB: d6ex5a1, d6ex5b1
    automated match to d1xrea2
    complexed with mn; mutant

Details for d6ex5b2

PDB Entry: 6ex5 (more details), 1.75 Å

PDB Description: staphylococcus aureus triple mutant of superoxide dismutase sodm
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6ex5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ex5b2 d.44.1.0 (B:91-199) automated matches {Staphylococcus aureus [TaxId: 1280]}
nseekggviddikaqwgtldefknefankattlfgsgwtwlvvndgkleivttpnqdnpl
tegktpilgldvwehayylkyqnkrpdymtafwnivnwkkvdelyqaak

SCOPe Domain Coordinates for d6ex5b2:

Click to download the PDB-style file with coordinates for d6ex5b2.
(The format of our PDB-style files is described here.)

Timeline for d6ex5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ex5b1