SCOPe 2.07: Domain d1gmqa_: 1gmq A:

Lineage for d1gmqa_ (1gmq A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
   Uniprot P05798

8. Domain d1gmqa_: 1gmq A: [36039]
   complexed with so4

Details for d1gmqa_

PDB Entry: 1gmq, 1.8 Å

PDB Description: complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution

PDB Compounds: (A:) ribonuclease sa

SCOPe Domain Sequences for d1gmqa_:

Sequence; same for both SEQRES and ATOM records:

>d1gmqa_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

Timeline for d1gmqa_:

• d1gmqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1gmqa_ appears in SCOPe 2.06
  
• d1gmqa_ appears in the current release, SCOPe 2.08