![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (38 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [346685] (6 PDB entries) |
![]() | Domain d6ex3d1: 6ex3 D:2-91 [360379] Other proteins in same PDB: d6ex3a2, d6ex3b2, d6ex3c2, d6ex3d2 automated match to d2rcva1 complexed with fe |
PDB Entry: 6ex3 (more details), 2.2 Å
SCOPe Domain Sequences for d6ex3d1:
Sequence, based on SEQRES records: (download)
>d6ex3d1 a.2.11.0 (D:2-91) automated matches {Staphylococcus aureus [TaxId: 1280]} afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld svpaniqtavrnnggghlnhslfwellspn
>d6ex3d1 a.2.11.0 (D:2-91) automated matches {Staphylococcus aureus [TaxId: 1280]} afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld stavrnnggghlnhslfwellspn
Timeline for d6ex3d1: