Lineage for d6bnna1 (6bnn A:9-152)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. Protein automated matches [190239] (26 species)
    not a true protein
  7. Species Maize (Zea mays) [TaxId:4577] [360358] (4 PDB entries)
  8. Domain d6bnna1: 6bnn A:9-152 [360371]
    automated match to d4mtsa_
    complexed with co, fmt, gsh; mutant

Details for d6bnna1

PDB Entry: 6bnn (more details), 1.55 Å

PDB Description: crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d6bnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bnna1 d.32.1.0 (A:9-152) automated matches {Maize (Zea mays) [TaxId: 4577]}
kaaeavvdwhkhdskrmlhavyrvgdldrtikyytecfgmkllrkrdvpdekytnaflgf
gpentnfaveltynygvdkydigtgfghfaianddvyklaenikskggkitrepgpvkgg
stviafaqdpdgymfeliqradtp

SCOPe Domain Coordinates for d6bnna1 are not available.

Timeline for d6bnna1:

Domains from same chain:
(mouse over for more information)
d6bnna2