Lineage for d6bnxa2 (6bnx A:153-290)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. Protein automated matches [190239] (26 species)
    not a true protein
  7. Species Maize (Zea mays) [TaxId:4577] [360358] (4 PDB entries)
  8. Domain d6bnxa2: 6bnx A:153-290 [360364]
    automated match to d4mtsa_
    complexed with co; mutant

Details for d6bnxa2

PDB Entry: 6bnx (more details), 1.8 Å

PDB Description: crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3)
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d6bnxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bnxa2 d.32.1.0 (A:153-290) automated matches {Maize (Zea mays) [TaxId: 4577]}
eplcqvmlrvgdlersikfyekalgmkllrkkdvpdykytiamlgyadedkttvleltyn
ygvteyskgnayaqvaigtndvyksaeavdlatkelggkilrqpgplpgintkiasfvdp
dgwkvelvdntdflkelh

SCOPe Domain Coordinates for d6bnxa2 are not available.

Timeline for d6bnxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bnxa1