Lineage for d6bnxa2 (6bnx A:153-290)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (26 species)
not a true protein
Species Maize (Zea mays) [TaxId:4577] [360358] (4 PDB entries) 
Domain d6bnxa2: 6bnx A:153-290 [360364]
automated match to d4mtsa_
complexed with co; mutant
Details for d6bnxa2
PDB Entry: 6bnx (more details), 1.8 Å
PDB Description: crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3)
PDB Compounds: (A:) lactoylglutathione lyaseSCOPe Domain Sequences for d6bnxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnxa2 d.32.1.0 (A:153-290) automated matches {Maize (Zea mays) [TaxId: 4577]}
eplcqvmlrvgdlersikfyekalgmkllrkkdvpdykytiamlgyadedkttvleltyn
ygvteyskgnayaqvaigtndvyksaeavdlatkelggkilrqpgplpgintkiasfvdp
dgwkvelvdntdflkelh
SCOPe Domain Coordinates for d6bnxa2:
Click to download the PDB-style file with coordinates for d6bnxa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6bnxa2:
- d6bnxa2 first appeared in SCOPe 2.07
View in 3D
