Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [360358] (4 PDB entries) |
Domain d6bnxa2: 6bnx A:153-290 [360364] automated match to d4mtsa_ complexed with co; mutant |
PDB Entry: 6bnx (more details), 1.8 Å
SCOPe Domain Sequences for d6bnxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnxa2 d.32.1.0 (A:153-290) automated matches {Maize (Zea mays) [TaxId: 4577]} eplcqvmlrvgdlersikfyekalgmkllrkkdvpdykytiamlgyadedkttvleltyn ygvteyskgnayaqvaigtndvyksaeavdlatkelggkilrqpgplpgintkiasfvdp dgwkvelvdntdflkelh
Timeline for d6bnxa2: