SCOPe 2.07: Domain d6b33b_: 6b33 B:

Lineage for d6b33b_ (6b33 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d6b33b_: 6b33 B: [360355]
   automated match to d4zjrb_
   complexed with cf7

Details for d6b33b_

PDB Entry: 6b33, 2.48 Å

PDB Description: structure of rorgt in complex with a novel inverse agonist 3

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6b33b_:

Sequence; same for both SEQRES and ATOM records:

>d6b33b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhver

Timeline for d6b33b_:

• d6b33b_ is new in SCOPe 2.07-stable
  
• d6b33b_ appears in the current release, SCOPe 2.08