Lineage for d1rgha_ (1rgh A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 496777Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 496778Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 496779Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 496897Protein RNase Sa [53935] (1 species)
  7. 496898Species Streptomyces aureofaciens [TaxId:1894] [53936] (20 PDB entries)
  8. 496907Domain d1rgha_: 1rgh A: [36032]

Details for d1rgha_

PDB Entry: 1rgh (more details), 1.2 Å

PDB Description: hydrolase, guanyloribonuclease

SCOP Domain Sequences for d1rgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgha_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1rgha_:

Click to download the PDB-style file with coordinates for d1rgha_.
(The format of our PDB-style files is described here.)

Timeline for d1rgha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rghb_