SCOP 1.73: Domain d1rggb_: 1rgg B:

Lineage for d1rggb_ (1rgg B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)

8. Domain d1rggb_: 1rgg B: [36031]
   complexed with so4

Details for d1rggb_

PDB Entry: 1rgg, 1.2 Å

PDB Description: hydrolase, guanyloribonuclease

PDB Compounds: (B:) Ribonuclease

SCOP Domain Sequences for d1rggb_:

Sequence; same for both SEQRES and ATOM records:

>d1rggb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

Timeline for d1rggb_:

• d1rggb_ first appeared (with stable ids) in SCOP 1.55
  
• d1rggb_ appears in SCOP 1.71
  
• d1rggb_ appears in SCOP 1.75
  
• d1rggb_ appears in the current release, SCOPe 2.08