Lineage for d1rggb_ (1rgg B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) Protein RNase Sa [53935] (1 species) Species Streptomyces aureofaciens [TaxId:1894] [53936] (12 PDB entries) 
Domain d1rggb_: 1rgg B: [36031]
Details for d1rggb_
PDB Entry: 1rgg (more details), 1.2 Å
PDB Description: hydrolase, guanyloribonuclease
SCOP Domain Sequences for d1rggb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rggb_ d.1.1.1 (B:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc
SCOP Domain Coordinates for d1rggb_:
Click to download the PDB-style file with coordinates for d1rggb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rggb_:
- d1rggb_ appears in SCOP 1.57
- d1rggb_ appears in the current release, SCOPe 2.08
View in 3D
