| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries) |
| Domain d6myaf2: 6mya F:330-491 [360307] Other proteins in same PDB: d6myaa1, d6myaa3, d6myab1, d6myac1, d6myad1, d6myae1, d6myae3, d6myaf1 automated match to d4wsrd2 complexed with edo, nag, peg |
PDB Entry: 6mya (more details), 2.05 Å
SCOPe Domain Sequences for d6myaf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6myaf2 h.3.1.0 (F:330-491) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqfttvgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydypky
Timeline for d6myaf2: