Lineage for d1rgga_ (1rgg A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531118Protein RNase Sa [53935] (1 species)
  7. 2531119Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 2531123Domain d1rgga_: 1rgg A: [36030]
    complexed with so4

Details for d1rgga_

PDB Entry: 1rgg (more details), 1.2 Å

PDB Description: hydrolase, guanyloribonuclease
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1rgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgga_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d1rgga_:

Click to download the PDB-style file with coordinates for d1rgga_.
(The format of our PDB-style files is described here.)

Timeline for d1rgga_: