![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
![]() | Protein automated matches [190537] (10 species) not a true protein |
![]() | Species Afifella pfennigii [TaxId:209897] [360243] (3 PDB entries) |
![]() | Domain d6hdvb_: 6hdv B: [360288] automated match to d4jnjd_ |
PDB Entry: 6hdv (more details), 2.16 Å
SCOPe Domain Sequences for d6hdvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hdvb_ b.61.1.0 (B:) automated matches {Afifella pfennigii [TaxId: 209897]} qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs dtftlvnkamketpkm
Timeline for d6hdvb_: