Lineage for d1rgea_ (1rge A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 128815Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 128816Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 128817Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 128944Protein RNase Sa [53935] (1 species)
  7. 128945Species Streptomyces aureofaciens [TaxId:1894] [53936] (15 PDB entries)
  8. 128946Domain d1rgea_: 1rge A: [36028]

Details for d1rgea_

PDB Entry: 1rge (more details), 1.15 Å

PDB Description: hydrolase, guanyloribonuclease

SCOP Domain Sequences for d1rgea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgea_ d.1.1.1 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1rgea_:

Click to download the PDB-style file with coordinates for d1rgea_.
(The format of our PDB-style files is described here.)

Timeline for d1rgea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rgeb_