SCOPe 2.07: Domain d1af2a2: 1af2 A:151-294

Lineage for d1af2a2 (1af2 A:151-294)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
   strand 5 is antiparallel to strand 4

6. Protein Two-domain cytidine deaminase [53929] (1 species)
   duplication: consists of two similar domains; contains extra helices in the N-terminal domain

7. Species Escherichia coli [TaxId:562] [53930] (4 PDB entries)

8. Domain d1af2a2: 1af2 A:151-294 [36027]
   complexed with u, zn

Details for d1af2a2

PDB Entry: 1af2, 2.3 Å

PDB Description: crystal structure of cytidine deaminase complexed with uridine

PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d1af2a2:

Sequence; same for both SEQRES and ATOM records:

>d1af2a2 c.97.1.1 (A:151-294) Two-domain cytidine deaminase {Escherichia coli [TaxId: 562]}
greahalrdylpdafgpkdleiktllmdeqdhgyaltgdalsqaaiaaanrshmpysksp
sgvaleckdgrifsgsyaenaafnptlpplqgalillnlkgydypdiqravlaekadapl
iqwdatsatlkalgchsidrvlla

Timeline for d1af2a2:

• d1af2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1af2a2 appears in SCOPe 2.06
  
• d1af2a2 appears in the current release, SCOPe 2.08