Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Peptoclostridium difficile [TaxId:272563] [360251] (1 PDB entry) |
Domain d6mx2l_: 6mx2 L: [360253] automated match to d1yg6a_ complexed with gol, na |
PDB Entry: 6mx2 (more details), 2.5 Å
SCOPe Domain Sequences for d6mx2l_:
Sequence, based on SEQRES records: (download)
>d6mx2l_ c.14.1.1 (L:) automated matches {Peptoclostridium difficile [TaxId: 272563]} lvpvvveqtgrgersydifsrllkdriiflgdqvndataglivaqllfleaedpdkdihl yinspggsitsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseimi hqplggaqgqatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleake yglidevftkr
>d6mx2l_ c.14.1.1 (L:) automated matches {Peptoclostridium difficile [TaxId: 272563]} lvpvvvsydifsrllkdriiflgdqvndataglivaqllfleaedpdkdihlyinspggs itsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseimihqplggaq gqatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleakeyglidevf tkr
Timeline for d6mx2l_: