Lineage for d1ctua2 (1ctu A:151-294)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525735Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2525764Protein Two-domain cytidine deaminase [53929] (1 species)
    duplication: consists of two similar domains; contains extra helices in the N-terminal domain
  7. 2525765Species Escherichia coli [TaxId:562] [53930] (4 PDB entries)
  8. 2525769Domain d1ctua2: 1ctu A:151-294 [36025]
    complexed with zeb, zn

Details for d1ctua2

PDB Entry: 1ctu (more details), 2.3 Å

PDB Description: transition-state selectivity for a single oh group during catalysis by cytidine deaminase
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d1ctua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctua2 c.97.1.1 (A:151-294) Two-domain cytidine deaminase {Escherichia coli [TaxId: 562]}
greahalrdylpdafgpkdleiktllmdeqdhgyaltgdalsqaaiaaanrshmpysksp
sgvaleckdgrifsgsyaenaafnptlpplqgalillnlkgydypdiqravlaekadapl
iqwdatsatlkalgchsidrvlla

SCOPe Domain Coordinates for d1ctua2:

Click to download the PDB-style file with coordinates for d1ctua2.
(The format of our PDB-style files is described here.)

Timeline for d1ctua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ctua1