Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.1: Cytidine deaminase [53928] (3 proteins) strand 5 is antiparallel to strand 4 |
Protein Two-domain cytidine deaminase [53929] (1 species) duplication: consists of two similar domains; contains extra helices in the N-terminal domain |
Species Escherichia coli [TaxId:562] [53930] (4 PDB entries) |
Domain d1ctta2: 1ctt A:151-294 [36023] complexed with dhz, zn |
PDB Entry: 1ctt (more details), 2.2 Å
SCOP Domain Sequences for d1ctta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctta2 c.97.1.1 (A:151-294) Two-domain cytidine deaminase {Escherichia coli [TaxId: 562]} greahalrdylpdafgpkdleiktllmdeqdhgyaltgdalsqaaiaaanrshmpysksp sgvaleckdgrifsgsyaenaafnptlpplqgalillnlkgydypdiqravlaekadapl iqwdatsatlkalgchsidrvlla
Timeline for d1ctta2: