Lineage for d6ffma_ (6ffm A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. Protein automated matches [190710] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. Domain d6ffma_: 6ffm A: [360227]
    automated match to d4cxta_
    complexed with d8n

Details for d6ffma_

PDB Entry: 6ffm (more details), 2.2 Å

PDB Description: crystal structure of human keap1 btb domain in complex with isoxazoline-based inhibitor
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d6ffma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ffma_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka
mftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvr
acadflvqqld

SCOPe Domain Coordinates for d6ffma_ are not available.

Timeline for d6ffma_: