Lineage for d1ctt_1 (1ctt 1-150)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.97: Cytidine deaminase [53926] (1 superfamily) Superfamily c.97.1: Cytidine deaminase [53927] (1 family) 
Family c.97.1.1: Cytidine deaminase [53928] (1 protein) Protein Cytidine deaminase [53929] (1 species) Species Escherichia coli [TaxId:562] [53930] (4 PDB entries) 
Domain d1ctt_1: 1ctt 1-150 [36022]
Details for d1ctt_1
PDB Entry: 1ctt (more details), 2.2 Å
PDB Description: transition-state selectivity for a single oh group during catalysis by cytidine deaminase
SCOP Domain Sequences for d1ctt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctt_1 c.97.1.1 (1-150) Cytidine deaminase {Escherichia coli}
mhprfqtafaqladnlqsalepiladkyfpalltgeqvsslksatgldedalafallpla
aacartplsnfnvgaiargvsgtwyfganmefigatmqqtvhaeqsaishawlsgekala
aitvnytpcghcrqfmnelnsgldlrihlp
SCOP Domain Coordinates for d1ctt_1:
Click to download the PDB-style file with coordinates for d1ctt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ctt_1:
- d1ctt_1 appears in SCOP 1.57
- d1ctt_1 appears in the current release, SCOPe 2.08, called d1ctta1
View in 3D
