Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Cow (Bos taurus) [TaxId:9913] [224919] (41 PDB entries) |
Domain d6e2bg_: 6e2b G: [360215] automated match to d1ogwa_ complexed with gol, pt7, so4 |
PDB Entry: 6e2b (more details), 1.45 Å
SCOPe Domain Sequences for d6e2bg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e2bg_ d.15.1.1 (G:) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d6e2bg_: