Lineage for d6dnda_ (6dnd A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [346320] (5 PDB entries)
  8. Domain d6dnda_: 6dnd A: [360211]
    automated match to d3wzfa_
    complexed with pg4, plp

Details for d6dnda_

PDB Entry: 6dnd (more details), 2.1 Å

PDB Description: crystal structure of wild-type (wt) human glutamate oxaloacetate transaminase 1 (got1)
PDB Compounds: (A:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d6dnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dnda_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Human (Homo sapiens) [TaxId: 9606]}
ppsvfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkia
ndnslnheylpilglaefrscasrlalgddspalkekrvggvqslggtgalrigadflar
wyngtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenap
efsivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawair
yfvsegfeffcaqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaq
garivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfs
ftglnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtk

SCOPe Domain Coordinates for d6dnda_ are not available.

Timeline for d6dnda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6dndb_