![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
![]() | Protein Two-domain cytidine deaminase [53929] (1 species) duplication: consists of two similar domains; contains extra helices in the N-terminal domain |
![]() | Species Escherichia coli [TaxId:562] [53930] (4 PDB entries) |
![]() | Domain d1alna2: 1aln A:151-294 [36021] complexed with ctd, zn |
PDB Entry: 1aln (more details), 2.3 Å
SCOPe Domain Sequences for d1alna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1alna2 c.97.1.1 (A:151-294) Two-domain cytidine deaminase {Escherichia coli [TaxId: 562]} greahalrdylpdafgpkdleiktllmdeqdhgyaltgdalsqaaiaaanrshmpysksp sgvaleckdgrifsgsyaenaafnptlpplqgalillnlkgydypdiqravlaekadapl iqwdatsatlkalgchsidrvlla
Timeline for d1alna2: