Lineage for d1aln_1 (1aln 1-150)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28510Fold c.97: Cytidine deaminase [53926] (1 superfamily)
  4. 28511Superfamily c.97.1: Cytidine deaminase [53927] (1 family) (S)
  5. 28512Family c.97.1.1: Cytidine deaminase [53928] (1 protein)
  6. 28513Protein Cytidine deaminase [53929] (1 species)
  7. 28514Species Escherichia coli [TaxId:562] [53930] (4 PDB entries)
  8. 28515Domain d1aln_1: 1aln 1-150 [36020]

Details for d1aln_1

PDB Entry: 1aln (more details), 2.3 Å

PDB Description: crystal structure of cytidine deaminase complexed with 3-deazacytidine

SCOP Domain Sequences for d1aln_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aln_1 c.97.1.1 (1-150) Cytidine deaminase {Escherichia coli}
mhprfqtafaqladnlqsalepiladkyfpalltgeqvsslksatgldedalafallpla
aacartplsnfnvgaiargvsgtwyfganmefigatmqqtvhaeqsaishawlsgekala
aitvnytpcghcrqfmnelnsgldlrihlp

SCOP Domain Coordinates for d1aln_1:

Click to download the PDB-style file with coordinates for d1aln_1.
(The format of our PDB-style files is described here.)

Timeline for d1aln_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aln_2