Lineage for d1c4aa1 (1c4a A:210-574)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711865Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 711866Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
  5. 711867Family c.96.1.1: Fe-only hydrogenase [53921] (2 proteins)
  6. 711872Protein Fe-only hydrogenase, catalytic domain [53922] (1 species)
    includes C-terminal region homologous to the smaller subunit of Desulfovidrio hydrogenase
  7. 711873Species Clostridium pasteurianum [TaxId:1501] [53923] (3 PDB entries)
  8. 711876Domain d1c4aa1: 1c4a A:210-574 [36017]
    Other proteins in same PDB: d1c4aa2, d1c4aa3

Details for d1c4aa1

PDB Entry: 1c4a (more details), 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum
PDB Compounds: (A:) protein (fe-only hydrogenase)

SCOP Domain Sequences for d1c4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4aa1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOP Domain Coordinates for d1c4aa1:

Click to download the PDB-style file with coordinates for d1c4aa1.
(The format of our PDB-style files is described here.)

Timeline for d1c4aa1: