SCOPe 2.08: Domain d6cmpa2: 6cmp A:111-218

Lineage for d6cmpa2 (6cmp A:111-218)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d6cmpa2: 6cmp A:111-218 [360169]
   Other proteins in same PDB: d6cmpa3, d6cmpb3
   automated match to d3ps5a2
   mutant

Details for d6cmpa2

PDB Entry: 6cmp, 1.8 Å

PDB Description: closed structure of inactive shp2 mutant c459e

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6cmpa2:

Sequence; same for both SEQRES and ATOM records:

>d6cmpa2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Timeline for d6cmpa2:

• d6cmpa2 first appeared in SCOPe 2.07