Lineage for d6e42c_ (6e42 C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 proteins)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. Protein automated matches [190585] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187592] (51 PDB entries)
  8. Domain d6e42c_: 6e42 C: [360155]
    automated match to d5wmxb_
    complexed with hem, hqj, po4

Details for d6e42c_

PDB Entry: 6e42 (more details), 2.1 Å

PDB Description: crystal structure of human indoleamine 2,3-dioxygenase 1 (ido1) in complex with ferric heme and 4-chlorophenyl imidazole
PDB Compounds: (C:) Indoleamine 2,3-dioxygenase 1

SCOPe Domain Sequences for d6e42c_:

Sequence, based on SEQRES records: (download)

>d6e42c_ a.266.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhksqrlar
lvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanwkkkdpn
kpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerdtllkal
leiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwedpkefa
ggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnpsvrefv
lskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsedpskleakgtg
gtdlmnflktvrstteksllk

Sequence, based on observed residues (ATOM records): (download)

>d6e42c_ a.266.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhksqrlar
lvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanwkkkdpn
kpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerdtllkal
leiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwedpkefa
ggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnpsvrefv
lskgdaglreaydacvkalvslrsyhlqivtkyilipasqggtdlmnflktvrstteksl
lk

SCOPe Domain Coordinates for d6e42c_ are not available.

Timeline for d6e42c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6e42a_, d6e42b_, d6e42d_