Lineage for d6df7b_ (6df7 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [360152] (2 PDB entries)
  8. Domain d6df7b_: 6df7 B: [360154]
    automated match to d3uv2a_
    complexed with g9v

Details for d6df7b_

PDB Entry: 6df7 (more details), 2 Å

PDB Description: taf1-bd2 in complex with cpd27 (6-(but-3-en-1-yl)-4-(1-methyl-6- (morpholine-4-carbonyl)-1h-benzo[d]imidazol-4-yl)-1,6-dihydro-7h- pyrrolo[2,3-c]pyridin-7-one)
PDB Compounds: (B:) Transcription initiation factor TFIID subunit

SCOPe Domain Sequences for d6df7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6df7b_ a.29.2.0 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
a

SCOPe Domain Coordinates for d6df7b_ are not available.

Timeline for d6df7b_:

Domains from other chains:
(mouse over for more information)
d6df7a_