Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries) |
Domain d6cmra3: 6cmr A:219-528 [360151] Other proteins in same PDB: d6cmra1, d6cmra2 automated match to d2b3oa3 complexed with 5od; mutant |
PDB Entry: 6cmr (more details), 2.21 Å
SCOPe Domain Sequences for d6cmra3:
Sequence, based on SEQRES records: (download)
>d6cmra3 c.45.1.0 (A:219-528) automated matches {Human (Homo sapiens) [TaxId: 9606]} trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav qhyietlqrr
>d6cmra3 c.45.1.0 (A:219-528) automated matches {Human (Homo sapiens) [TaxId: 9606]} trinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenknknryknilpfdh trvvlhsdyinaniimpekksyiatqgclqntvndfwrmvfqensrvivmttkevergks kcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpd hgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvd cdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrr
Timeline for d6cmra3: