SCOP 1.73: Domain d1qlvb2: 1qlv B:236-393

Lineage for d1qlvb2 (1qlv B:236-393)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species)

7. Species Gerbera hybrid cultivar [TaxId:18101] [53918] (2 PDB entries)

8. Domain d1qlvb2: 1qlv B:236-393 [36014]

Details for d1qlvb2

PDB Entry: 1qlv, 2.1 Å

PDB Description: pyrone synthase (pys) from gerbera hybrida

PDB Compounds: (B:) pyrone synthase

SCOP Domain Sequences for d1qlvb2:

Sequence; same for both SEQRES and ATOM records:

>d1qlvb2 c.95.1.2 (B:236-393) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvr

Timeline for d1qlvb2:

• d1qlvb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qlvb2 appears in SCOP 1.71
  
• d1qlvb2 appears in SCOP 1.75
  
• d1qlvb2 appears in the current release, SCOPe 2.08