Lineage for d6cvld2 (6cvl D:241-343)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. Family d.58.18.13: NIL domain-like [160322] (2 proteins)
    Pfam PF09383
  6. Protein Methionine import ATP-binding protein MetN [160323] (2 species)
  7. Species Escherichia coli [TaxId:562] [160325] (3 PDB entries)
    Uniprot P30750 241-343! Uniprot P30750 247-343
  8. Domain d6cvld2: 6cvl D:241-343 [360136]
    Other proteins in same PDB: d6cvla_, d6cvlb_, d6cvlc1, d6cvlc3, d6cvld1, d6cvld3
    automated match to d3dhwc2
    complexed with ags, hg, iod

Details for d6cvld2

PDB Entry: 6cvl (more details), 2.9499999999999997 Å

PDB Description: crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein
PDB Compounds: (D:) MetN nucleotide-binding subunit

SCOPe Domain Sequences for d6cvld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvld2 d.58.18.13 (D:241-343) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnaiisaq
mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv

SCOPe Domain Coordinates for d6cvld2 are not available.

Timeline for d6cvld2:

Domains from same chain:
(mouse over for more information)
d6cvld1, d6cvld3
Domains from other chains:
(mouse over for more information)
d6cvla_, d6cvlb_, d6cvlc1, d6cvlc2, d6cvlc3