SCOPe 2.08: Domain d6cvlc1: 6cvl C:1-240

Lineage for d6cvlc1 (6cvl C:1-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Methionine import ATP-binding protein MetN [159571] (1 species)

7. Species Escherichia coli [TaxId:562] [159572] (2 PDB entries)
   Uniprot P30750 1-240

8. Domain d6cvlc1: 6cvl C:1-240 [360135]
   Other proteins in same PDB: d6cvla_, d6cvlb_, d6cvlc2, d6cvlc3, d6cvld2, d6cvld3
   automated match to d3dhwc1
   complexed with ags, hg, iod

Details for d6cvlc1

PDB Entry: 6cvl, 2.95 Å

PDB Description: crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein

PDB Compounds: (C:) MetN nucleotide-binding subunit

SCOPe Domain Sequences for d6cvlc1:

Sequence; same for both SEQRES and ATOM records:

>d6cvlc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg
svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr
vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsil
ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf

Timeline for d6cvlc1:

• d6cvlc1 first appeared in SCOPe 2.07