Lineage for d6cvld1 (6cvl D:1-240)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. Protein Methionine import ATP-binding protein MetN [159571] (1 species)
  7. Species Escherichia coli [TaxId:562] [159572] (2 PDB entries)
    Uniprot P30750 1-240
  8. Domain d6cvld1: 6cvl D:1-240 [360130]
    Other proteins in same PDB: d6cvla_, d6cvlb_, d6cvlc2, d6cvlc3, d6cvld2, d6cvld3
    automated match to d3dhwc1
    complexed with ags, hg, iod

Details for d6cvld1

PDB Entry: 6cvl (more details), 2.9499999999999997 Å

PDB Description: crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein
PDB Compounds: (D:) MetN nucleotide-binding subunit

SCOPe Domain Sequences for d6cvld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvld1 c.37.1.12 (D:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg
svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr
vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsil
ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf

SCOPe Domain Coordinates for d6cvld1 are not available.

Timeline for d6cvld1:

Domains from same chain:
(mouse over for more information)
d6cvld2, d6cvld3
Domains from other chains:
(mouse over for more information)
d6cvla_, d6cvlb_, d6cvlc1, d6cvlc2, d6cvlc3