Lineage for d6gm0a1 (6gm0 A:2-126)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. Protein automated matches [191164] (24 species)
    not a true protein
  7. Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)
  8. Domain d6gm0a1: 6gm0 A:2-126 [360117]
    Other proteins in same PDB: d6gm0a2, d6gm0a3, d6gm0a4, d6gm0b2, d6gm0b3, d6gm0b4
    automated match to d3c8ya2
    complexed with 402, fes, mg, sf4

Details for d6gm0a1

PDB Entry: 6gm0 (more details), 2.11 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant e279q
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d6gm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gm0a1 d.15.4.0 (A:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp

SCOPe Domain Coordinates for d6gm0a1 are not available.

Timeline for d6gm0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gm0a2, d6gm0a3, d6gm0a4
View in 3D
Domains from other chains:
(mouse over for more information)
d6gm0b1, d6gm0b2, d6gm0b3, d6gm0b4