SCOPe 2.07: Domain d6hjeb1: 6hje B:43-393

Lineage for d6hjeb1 (6hje B:43-393)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [267764] (5 PDB entries)

8. Domain d6hjeb1: 6hje B:43-393 [360109]
   Other proteins in same PDB: d6hjea2, d6hjeb2
   automated match to d1w62a_
   complexed with 7n0, po4

Details for d6hjeb1

PDB Entry: 6hje, 2 Å

PDB Description: trypanosoma cruzi proline racemase in complex with inhibitor ng-p27

PDB Compounds: (B:) Proline racemase A

SCOPe Domain Sequences for d6hjeb1:

Sequence; same for both SEQRES and ATOM records:

>d6hjeb1 d.21.1.0 (B:43-393) automated matches {Trypanosoma cruzi [TaxId: 5693]}
kksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddmf
gaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldt
paglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffai
vpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpea
nyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeer
ipgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkq

Timeline for d6hjeb1:

• d6hjeb1 is new in SCOPe 2.07-stable
  
• d6hjeb1 appears in the current release, SCOPe 2.08