Lineage for d5zz6d1 (5zz6 D:9-79)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308561Species Thermotoga maritima [TaxId:243274] [360039] (3 PDB entries)
  8. 2308567Domain d5zz6d1: 5zz6 D:9-79 [360104]
    Other proteins in same PDB: d5zz6a2, d5zz6b2, d5zz6c2, d5zz6d2
    automated match to d1r72e3
    complexed with adp, nad

Details for d5zz6d1

PDB Entry: 5zz6 (more details), 2.2 Å

PDB Description: redox-sensing transcriptional repressor rex
PDB Compounds: (D:) Redox-sensing transcriptional repressor Rex 1

SCOPe Domain Sequences for d5zz6d1:

Sequence, based on SEQRES records: (download)

>d5zz6d1 a.4.5.0 (D:9-79) automated matches {Thermotoga maritima [TaxId: 243274]}
vskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgvgynveh
lydaigeilgv

Sequence, based on observed residues (ATOM records): (download)

>d5zz6d1 a.4.5.0 (D:9-79) automated matches {Thermotoga maritima [TaxId: 243274]}
vskrlvsyymclerlldegvevseelarasqirkdlsyfgefgkrnvehlydaigeilgv

SCOPe Domain Coordinates for d5zz6d1:

Click to download the PDB-style file with coordinates for d5zz6d1.
(The format of our PDB-style files is described here.)

Timeline for d5zz6d1: