Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6h39v_: 6h39 V: [360101] Other proteins in same PDB: d6h39b_, d6h39c1, d6h39c2, d6h39d_, d6h39e_, d6h39f_, d6h39g_, d6h39i_, d6h39j_, d6h39k_, d6h39l_, d6h39n_, d6h39o_, d6h39p_, d6h39q1, d6h39q2, d6h39r_, d6h39s_, d6h39t_, d6h39u_, d6h39w_, d6h39x_, d6h39y_, d6h39z_ automated match to d5fg9h_ complexed with cl, fgy, mes, mg, so4 |
PDB Entry: 6h39 (more details), 2.5 Å
SCOPe Domain Sequences for d6h39v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h39v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d6h39v_:
View in 3D Domains from other chains: (mouse over for more information) d6h39a_, d6h39b_, d6h39c1, d6h39c2, d6h39d_, d6h39e_, d6h39f_, d6h39g_, d6h39h_, d6h39i_, d6h39j_, d6h39k_, d6h39l_, d6h39m_, d6h39n_, d6h39o_, d6h39p_, d6h39q1, d6h39q2, d6h39r_, d6h39s_, d6h39t_, d6h39u_, d6h39w_, d6h39x_, d6h39y_, d6h39z_ |