Lineage for d6gjia_ (6gji A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416162Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2416177Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (129 PDB entries)
    Uniprot P05092
  8. 2416249Domain d6gjia_: 6gji A: [360100]
    automated match to d1w8ma_
    complexed with f1e, gol

Details for d6gjia_

PDB Entry: 6gji (more details), 1.6 Å

PDB Description: cyclophilin a complexed with the tri-vector ligand 8.
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d6gjia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d6gjia_:

Click to download the PDB-style file with coordinates for d6gjia_.
(The format of our PDB-style files is described here.)

Timeline for d6gjia_: