Lineage for d1ee0b2 (1ee0 B:236-394)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711668Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 711855Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species)
  7. 711856Species Gerbera hybrid cultivar [TaxId:18101] [53918] (2 PDB entries)
  8. 711860Domain d1ee0b2: 1ee0 B:236-394 [36010]
    complexed with caa

Details for d1ee0b2

PDB Entry: 1ee0 (more details), 2.05 Å

PDB Description: 2-pyrone synthase complexed with acetoacetyl-coa
PDB Compounds: (B:) 2-pyrone synthase

SCOP Domain Sequences for d1ee0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee0b2 c.95.1.2 (B:236-394) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvrv

SCOP Domain Coordinates for d1ee0b2:

Click to download the PDB-style file with coordinates for d1ee0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ee0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee0b1