Lineage for d6gm1b2 (6gm1 B:127-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949457Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2949458Protein automated matches [229599] (4 species)
    not a true protein
  7. 2949459Species Clostridium pasteurianum [TaxId:1501] [279205] (17 PDB entries)
  8. 2949481Domain d6gm1b2: 6gm1 B:127-209 [360092]
    Other proteins in same PDB: d6gm1a1, d6gm1a3, d6gm1a4, d6gm1b1, d6gm1b3, d6gm1b4
    automated match to d3c8ya3
    complexed with 402, fes, mg, sf4

Details for d6gm1b2

PDB Entry: 6gm1 (more details), 2.05 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant e282a
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d6gm1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gm1b2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d6gm1b2:

Click to download the PDB-style file with coordinates for d6gm1b2.
(The format of our PDB-style files is described here.)

Timeline for d6gm1b2: