![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
![]() | Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species) |
![]() | Species Gerbera hybrid cultivar [TaxId:18101] [53918] (2 PDB entries) |
![]() | Domain d1ee0b1: 1ee0 B:20-235 [36009] complexed with caa |
PDB Entry: 1ee0 (more details), 2.05 Å
SCOPe Domain Sequences for d1ee0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee0b1 c.95.1.2 (B:20-235) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag vdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcseit ailfhgpnenhldslvaqalfgdgaaalivgsgphl
Timeline for d1ee0b1: