Lineage for d1ee0b1 (1ee0 B:20-235)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. Protein Pyrone synthase (PyS, chalcone synthase 2), N-terminal domain [419038] (1 species)
  7. Species Gerbera hybrid cultivar [TaxId:18101] [419522] (2 PDB entries)
  8. Domain d1ee0b1: 1ee0 B:20-235 [36009]
    Other proteins in same PDB: d1ee0a2, d1ee0b2
    complexed with caa
    has additional insertions and/or extensions that are not grouped together

Details for d1ee0b1

PDB Entry: 1ee0 (more details), 2.05 Å

PDB Description: 2-pyrone synthase complexed with acetoacetyl-coa
PDB Compounds: (B:) 2-pyrone synthase

SCOPe Domain Sequences for d1ee0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee0b1 c.95.1.2 (B:20-235) Pyrone synthase (PyS, chalcone synthase 2), N-terminal domain {Gerbera hybrid cultivar [TaxId: 18101]}
glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte
dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag
vdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcseit
ailfhgpnenhldslvaqalfgdgaaalivgsgphl

SCOPe Domain Coordinates for d1ee0b1 are not available.

Timeline for d1ee0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee0b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ee0a1, d1ee0a2