Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species) |
Species Gerbera hybrid cultivar [TaxId:18101] [53918] (2 PDB entries) |
Domain d1ee0a2: 1ee0 A:236-395 [36008] complexed with caa |
PDB Entry: 1ee0 (more details), 2.05 Å
SCOPe Domain Sequences for d1ee0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvrvt
Timeline for d1ee0a2: