SCOPe 2.08: Domain d1ee0a2: 1ee0 A:236-395

Lineage for d1ee0a2 (1ee0 A:236-395)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Pyrone synthase (PyS, chalcone synthase 2), C-terminal domain [419039] (1 species)

7. Species Gerbera hybrid cultivar [TaxId:18101] [419523] (2 PDB entries)

8. Domain d1ee0a2: 1ee0 A:236-395 [36008]
   Other proteins in same PDB: d1ee0a1, d1ee0b1
   complexed with caa

Details for d1ee0a2

PDB Entry: 1ee0, 2.05 Å

PDB Description: 2-pyrone synthase complexed with acetoacetyl-coa

PDB Compounds: (A:) 2-pyrone synthase

SCOPe Domain Sequences for d1ee0a2:

Sequence; same for both SEQRES and ATOM records:

>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2), C-terminal domain {Gerbera hybrid cultivar [TaxId: 18101]}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvrvt

Timeline for d1ee0a2:

• d1ee0a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ee0a2 appears in SCOPe 2.07