Lineage for d6hjea1 (6hje A:38-393)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939758Species Trypanosoma cruzi [TaxId:5693] [267764] (5 PDB entries)
  8. 2939765Domain d6hjea1: 6hje A:38-393 [360078]
    Other proteins in same PDB: d6hjea2, d6hjeb2
    automated match to d1w62a_
    complexed with 7n0, po4

Details for d6hjea1

PDB Entry: 6hje (more details), 2 Å

PDB Description: trypanosoma cruzi proline racemase in complex with inhibitor ng-p27
PDB Compounds: (A:) Proline racemase A

SCOPe Domain Sequences for d6hjea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hjea1 d.21.1.0 (A:38-393) automated matches {Trypanosoma cruzi [TaxId: 5693]}
eimrfkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprg
hddmfgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvp
vvldtpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafgg
nffaivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpp
tnpeanyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrv
lgeeripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkq

SCOPe Domain Coordinates for d6hjea1:

Click to download the PDB-style file with coordinates for d6hjea1.
(The format of our PDB-style files is described here.)

Timeline for d6hjea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6hjea2