Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.305: NAP-like [143112] (1 superfamily) core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix |
Superfamily d.305.1: NAP-like [143113] (2 families) |
Family d.305.1.0: automated matches [196445] (1 protein) not a true family |
Protein automated matches [196446] (6 species) not a true protein |
Species Pneumocystis carinii [TaxId:1408658] [360017] (1 PDB entry) |
Domain d5ypsd_: 5yps D: [360075] automated match to d5gpla_ complexed with 1pe, ca, gol, peg, pge |
PDB Entry: 5yps (more details), 2.1 Å
SCOPe Domain Sequences for d5ypsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ypsd_ d.305.1.0 (D:) automated matches {Pneumocystis carinii [TaxId: 1408658]} tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai fiaedlypnavkyftdalqe
Timeline for d5ypsd_: