SCOPe 2.03: Domain d1ee0a1: 1ee0 A:20-235

Lineage for d1ee0a1 (1ee0 A:20-235)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species)

7. Species Gerbera hybrid cultivar [TaxId:18101] [53918] (2 PDB entries)

8. Domain d1ee0a1: 1ee0 A:20-235 [36007]
   complexed with caa

Details for d1ee0a1

PDB Entry: 1ee0, 2.05 Å

PDB Description: 2-pyrone synthase complexed with acetoacetyl-coa

PDB Compounds: (A:) 2-pyrone synthase

SCOPe Domain Sequences for d1ee0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ee0a1 c.95.1.2 (A:20-235) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]}
glatilaigtatppncvaqadyadyyfrvtksehmvdlkekfkricektaikkrylalte
dylqenptmcefmapslnarqdlvvtgvpmlgkeaavkaidewglpkskithlifcttag
vdmpgadyqlvkllglspsvkrymlyqqgcaaggtvlrlakdlaennkgsrvlivcseit
ailfhgpnenhldslvaqalfgdgaaalivgsgphl

Timeline for d1ee0a1:

• d1ee0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ee0a1 appears in SCOPe 2.02
  
• d1ee0a1 appears in SCOPe 2.04
  
• d1ee0a1 appears in the current release, SCOPe 2.08