| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
| Protein automated matches [229599] (4 species) not a true protein |
| Species Clostridium pasteurianum [TaxId:1501] [279205] (17 PDB entries) |
| Domain d6gm8a2: 6gm8 A:127-209 [360069] Other proteins in same PDB: d6gm8a1, d6gm8a3, d6gm8a4, d6gm8b1, d6gm8b3, d6gm8b4 automated match to d3c8ya3 complexed with 402, fes, mg, sf4 |
PDB Entry: 6gm8 (more details), 1.96 Å
SCOPe Domain Sequences for d6gm8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gm8a2 d.58.1.0 (A:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks
Timeline for d6gm8a2:
View in 3DDomains from other chains: (mouse over for more information) d6gm8b1, d6gm8b2, d6gm8b3, d6gm8b4 |