![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
![]() | Domain d6gm8a1: 6gm8 A:2-126 [360068] Other proteins in same PDB: d6gm8a2, d6gm8a3, d6gm8a4, d6gm8b2, d6gm8b3, d6gm8b4 automated match to d3c8ya2 complexed with 402, fes, mg, sf4 |
PDB Entry: 6gm8 (more details), 1.96 Å
SCOPe Domain Sequences for d6gm8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gm8a1 d.15.4.0 (A:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]} ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras kpflp
Timeline for d6gm8a1:
![]() Domains from other chains: (mouse over for more information) d6gm8b1, d6gm8b2, d6gm8b3, d6gm8b4 |