Lineage for d5z0qj_ (5z0q J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897063Species Erwinia tasmaniensis [TaxId:465817] [360026] (1 PDB entry)
  8. 2897073Domain d5z0qj_: 5z0q J: [360067]
    automated match to d4dq6a_
    complexed with plp

Details for d5z0qj_

PDB Entry: 5z0q (more details), 2.77 Å

PDB Description: crystal structure of ovob
PDB Compounds: (J:) Aminotransferase, class I and II

SCOPe Domain Sequences for d5z0qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0qj_ c.67.1.0 (J:) automated matches {Erwinia tasmaniensis [TaxId: 465817]}
nfdqridrrhsdslkwkkyadrdilplwiadtdfraadciidalqqrvqqgvfgygvtse
alaevaiermesrfgwkiqpewlvflpgvvtginiavrafteahqstvsatpiyppffla
pklagrqhlsaalrleqqrwvldldshedrmsgnekllllcnphnpggtvyrrkeleaql
rfaqrhdllvcsdeihcdlvlepgvqhipfaslsddaaqrsitlmspsksfniaglgasl
avipnpelrarfnrmrkgmvpdvdvlayvaasaawregqpwldaqldylranrdmlaqhv
nrlpglsmvtpeasflgwidasglgvadpalffekhglgfssgrdfgndrfvrfnfgcpr
qlleealqrmtralt

SCOPe Domain Coordinates for d5z0qj_:

Click to download the PDB-style file with coordinates for d5z0qj_.
(The format of our PDB-style files is described here.)

Timeline for d5z0qj_: